Sterol regulatory element-binding proteins (SREBP) signaling (Homo sapiens)

From WikiPathways

Revision as of 14:56, 13 December 2012 by Sabinedaemen (Talk | contribs)
Jump to: navigation, search
ERNucleus18, 21163Golgi Lipogenic enzymesCOPII coated vesicle8Cholesterol efflux CleavageTranscription-TranslationSREstimulationInhibitionCatalysisNegative effectCofactorExact mechanism unknownLegendCholesterol synthesisUp regulationPositive effectInsulinSIRT1S1PmiRNA33bGSK3GlutaminemTORC1LXRPI3KTRC8UFAsimportin betaCholesterolSREBP2LPIN1AMPKmiRNA33aGlucoseNFYHMGCRATF6SCAPINSIG1PUFAsnSREBPOxysterolsAKTCDK86131, 32SCAP1025302712214, 23301915, 2617, 2957SCAPINSIG2INSIG1INSIG2SREBP1a,-c13, 24SREBP2SREBP1a,-cSREBP2SREBP1a,-cSAR1ASCAPSREBP2SREBP1a,-cSAR1BSAR1ASAR1BSEC23ASEC23BSEC24ASEC24BSEC24CSEC24DSEC13SEC31ASEC31BSEC13SEC23ASEC23BSEC24ASEC24BSEC24CSEC24DSAR1ASCAPSREBF2SREBP1a,-cSAR1BSEC31ASEC31BS2P22SCAPSREBP2SREBP1a,-cnSREBP1a,-cGeneSREnSREBP2GeneCholesterogenic enzymesLipoprotein metabolismSREBP2SREBP1a,-cCholesterol uptakeInsig1Insig2CofactorCREBSP128NFYCREBSP1YY19, 20YY1PGC-1beta11ARC4ARCLSSHMGCSMVDIDIFDPSFDFTSQLECYP51A1LPLLDLRSCARB1ACACAGPAFASNDBIACLYMDHPPARGACSSCDFatty aciddegradationFatty acid synthesisSIRT1


Description

Sterol regulatory element-binding protein (SREBP) are membrane-bound proteins that act as transcription factors. They regulate cholesterol biosynthesis and uptake, at a transcriptional level, to maintain cellular cholesterol homeostasis.

Please use the New WikiPathways

View approved pathways at the new wikipathways.org. This website will shutdown soon.

Quality Tags

Ontology Terms

 

Bibliography

View all...
  1. Yokoyama C, Wang X, Briggs MR, Admon A, Wu J, Hua X, Goldstein JL, Brown MS; ''SREBP-1, a basic-helix-loop-helix-leucine zipper protein that controls transcription of the low density lipoprotein receptor gene.''; Cell, 1993 PubMed Europe PMC Scholia
  2. Ruderman NB, Xu XJ, Nelson L, Cacicedo JM, Saha AK, Lan F, Ido Y; ''AMPK and SIRT1: a long-standing partnership?''; Am J Physiol Endocrinol Metab, 2010 PubMed Europe PMC Scholia
  3. Li Y, Xu S, Mihaylova MM, Zheng B, Hou X, Jiang B, Park O, Luo Z, Lefai E, Shyy JY, Gao B, Wierzbicki M, Verbeuren TJ, Shaw RJ, Cohen RA, Zang M; ''AMPK phosphorylates and inhibits SREBP activity to attenuate hepatic steatosis and atherosclerosis in diet-induced insulin-resistant mice.''; Cell Metab, 2011 PubMed Europe PMC Scholia
  4. Yellaturu CR, Deng X, Park EA, Raghow R, Elam MB; ''Insulin enhances the biogenesis of nuclear sterol regulatory element-binding protein (SREBP)-1c by posttranscriptional down-regulation of Insig-2A and its dissociation from SREBP cleavage-activating protein (SCAP).SREBP-1c complex.''; J Biol Chem, 2009 PubMed Europe PMC Scholia
  5. Brown MS, Goldstein JL; ''A proteolytic pathway that controls the cholesterol content of membranes, cells, and blood.''; Proc Natl Acad Sci U S A, 1999 PubMed Europe PMC Scholia
  6. Peterson TR, Sengupta SS, Harris TE, Carmack AE, Kang SA, Balderas E, Guertin DA, Madden KL, Carpenter AE, Finck BN, Sabatini DM; ''mTOR complex 1 regulates lipin 1 localization to control the SREBP pathway.''; Cell, 2011 PubMed Europe PMC Scholia
  7. Zhang Y, Lei T, Huang JF, Wang SB, Zhou LL, Yang ZQ, Chen XD; ''The link between fibroblast growth factor 21 and sterol regulatory element binding protein 1c during lipogenesis in hepatocytes.''; Mol Cell Endocrinol, 2011 PubMed Europe PMC Scholia
  8. Rottiers V, Näär AM; ''MicroRNAs in metabolism and metabolic disorders.''; Nat Rev Mol Cell Biol, 2012 PubMed Europe PMC Scholia
  9. Lin J, Yang R, Tarr PT, Wu PH, Handschin C, Li S, Yang W, Pei L, Uldry M, Tontonoz P, Newgard CB, Spiegelman BM; ''Hyperlipidemic effects of dietary saturated fats mediated through PGC-1beta coactivation of SREBP.''; Cell, 2005 PubMed Europe PMC Scholia
  10. Ye J, Davé UP, Grishin NV, Goldstein JL, Brown MS; ''Asparagine-proline sequence within membrane-spanning segment of SREBP triggers intramembrane cleavage by site-2 protease.''; Proc Natl Acad Sci U S A, 2000 PubMed Europe PMC Scholia
  11. Yamamoto T, Shimano H, Inoue N, Nakagawa Y, Matsuzaka T, Takahashi A, Yahagi N, Sone H, Suzuki H, Toyoshima H, Yamada N; ''Protein kinase A suppresses sterol regulatory element-binding protein-1C expression via phosphorylation of liver X receptor in the liver.''; J Biol Chem, 2007 PubMed Europe PMC Scholia
  12. Engelking LJ, Kuriyama H, Hammer RE, Horton JD, Brown MS, Goldstein JL, Liang G; ''Overexpression of Insig-1 in the livers of transgenic mice inhibits SREBP processing and reduces insulin-stimulated lipogenesis.''; J Clin Invest, 2004 PubMed Europe PMC Scholia
  13. Lee JN, Song B, DeBose-Boyd RA, Ye J; ''Sterol-regulated degradation of Insig-1 mediated by the membrane-bound ubiquitin ligase gp78.''; J Biol Chem, 2006 PubMed Europe PMC Scholia
  14. Krycer JR, Sharpe LJ, Luu W, Brown AJ; ''The Akt-SREBP nexus: cell signaling meets lipid metabolism.''; Trends Endocrinol Metab, 2010 PubMed Europe PMC Scholia
  15. Zeng L, Lu M, Mori K, Luo S, Lee AS, Zhu Y, Shyy JY; ''''; , PubMed Europe PMC Scholia
  16. Bennett MK, Ngo TT, Athanikar JN, Rosenfeld JM, Osborne TF; ''Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein.''; J Biol Chem, 1999 PubMed Europe PMC Scholia
  17. Takeuchi Y, Yahagi N, Izumida Y, Nishi M, Kubota M, Teraoka Y, Yamamoto T, Matsuzaka T, Nakagawa Y, Sekiya M, Iizuka Y, Ohashi K, Osuga J, Gotoda T, Ishibashi S, Itaka K, Kataoka K, Nagai R, Yamada N, Kadowaki T, Shimano H; ''Polyunsaturated fatty acids selectively suppress sterol regulatory element-binding protein-1 through proteolytic processing and autoloop regulatory circuit.''; J Biol Chem, 2010 PubMed Europe PMC Scholia
  18. Irisawa M, Inoue J, Ozawa N, Mori K, Sato R; ''The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage.''; J Biol Chem, 2009 PubMed Europe PMC Scholia
  19. Owen JL, Zhang Y, Bae SH, Farooqi MS, Liang G, Hammer RE, Goldstein JL, Brown MS; ''Insulin stimulation of SREBP-1c processing in transgenic rat hepatocytes requires p70 S6-kinase.''; Proc Natl Acad Sci U S A, 2012 PubMed Europe PMC Scholia
  20. Daemen S, Kutmon M, Evelo CT; ''A pathway approach to investigate the function and regulation of SREBPs.''; Genes Nutr, 2013 PubMed Europe PMC Scholia
  21. Shimano H; ''Sterol regulatory element-binding proteins (SREBPs): transcriptional regulators of lipid synthetic genes.''; Prog Lipid Res, 2001 PubMed Europe PMC Scholia
  22. Adams CM, Reitz J, De Brabander JK, Feramisco JD, Li L, Brown MS, Goldstein JL; ''Cholesterol and 25-hydroxycholesterol inhibit activation of SREBPs by different mechanisms, both involving SCAP and Insigs.''; J Biol Chem, 2004 PubMed Europe PMC Scholia
  23. Gong Y, Lee JN, Lee PC, Goldstein JL, Brown MS, Ye J; ''Sterol-regulated ubiquitination and degradation of Insig-1 creates a convergent mechanism for feedback control of cholesterol synthesis and uptake.''; Cell Metab, 2006 PubMed Europe PMC Scholia
  24. Radhakrishnan A, McConnell HM; ''Chemical activity of cholesterol in membranes.''; Biochemistry, 2000 PubMed Europe PMC Scholia
  25. Ponugoti B, Kim DH, Xiao Z, Smith Z, Miao J, Zang M, Wu SY, Chiang CM, Veenstra TD, Kemper JK; ''SIRT1 deacetylates and inhibits SREBP-1C activity in regulation of hepatic lipid metabolism.''; J Biol Chem, 2010 PubMed Europe PMC Scholia
  26. Radhakrishnan A, Ikeda Y, Kwon HJ, Brown MS, Goldstein JL; ''Sterol-regulated transport of SREBPs from endoplasmic reticulum to Golgi: oxysterols block transport by binding to Insig.''; Proc Natl Acad Sci U S A, 2007 PubMed Europe PMC Scholia
  27. Uttarwar L, Gao B, Ingram AJ, Krepinsky JC; ''SREBP-1 Activation by Glucose Mediates TGFخ² Upregulation in Mesangial Cells.''; Am J Physiol Renal Physiol, 2011 PubMed Europe PMC Scholia
  28. Sato R; ''Sterol metabolism and SREBP activation.''; Arch Biochem Biophys, 2010 PubMed Europe PMC Scholia
  29. Xia M, Liu Y, Guo H, Wang D, Wang Y, Ling W; ''Retinol binding protein 4 stimulates hepatic SREBP-1 and increases lipogenesis through PGC-1beta-dependent pathway.''; Hepatology, 2013 PubMed Europe PMC Scholia
  30. Ericsson J, Usheva A, Edwards PA; ''YY1 is a negative regulator of transcription of three sterol regulatory element-binding protein-responsive genes.''; J Biol Chem, 1999 PubMed Europe PMC Scholia
  31. Yang F, Vought BW, Satterlee JS, Walker AK, Jim Sun ZY, Watts JL, DeBeaumont R, Saito RM, Hyberts SG, Yang S, Macol C, Iyer L, Tjian R, van den Heuvel S, Hart AC, Wagner G, Näär AM; ''An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis.''; Nature, 2006 PubMed Europe PMC Scholia
  32. Jeon TI, Osborne TF; ''SREBPs: metabolic integrators in physiology and metabolism.''; Trends Endocrinol Metab, 2012 PubMed Europe PMC Scholia
  33. Nagoshi E, Imamoto N, Sato R, Yoneda Y; ''Nuclear import of sterol regulatory element-binding protein-2, a basic helix-loop-helix-leucine zipper (bHLH-Zip)-containing transcription factor, occurs through the direct interaction of importin beta with HLH-Zip.''; Mol Biol Cell, 1999 PubMed Europe PMC Scholia
  34. Yellaturu CR, Deng X, Cagen LM, Wilcox HG, Mansbach CM 2nd, Siddiqi SA, Park EA, Raghow R, Elam MB; ''Insulin enhances post-translational processing of nascent SREBP-1c by promoting its phosphorylation and association with COPII vesicles.''; J Biol Chem, 2009 PubMed Europe PMC Scholia
  35. Zhao X, Feng D, Wang Q, Abdulla A, Xie XJ, Zhou J, Sun Y, Yang ES, Liu LP, Vaitheesvaran B, Bridges L, Kurland IJ, Strich R, Ni JQ, Wang C, Ericsson J, Pessin JE, Ji JY, Yang F; ''Regulation of lipogenesis by cyclin-dependent kinase 8-mediated control of SREBP-1.''; J Clin Invest, 2012 PubMed Europe PMC Scholia
  36. Hao J, Liu S, Zhao S, Liu Q, Lv X, Chen H, Niu Y, Duan H; ''PI3K/Akt pathway mediates high glucose-induced lipogenesis and extracellular matrix accumulation in HKC cells through regulation of SREBP-1 and TGF-خ²1.''; Histochem Cell Biol, 2011 PubMed Europe PMC Scholia
  37. Chen G, Liang G, Ou J, Goldstein JL, Brown MS; ''Central role for liver X receptor in insulin-mediated activation of Srebp-1c transcription and stimulation of fatty acid synthesis in liver.''; Proc Natl Acad Sci U S A, 2004 PubMed Europe PMC Scholia
  38. Dif N, Euthine V, Gonnet E, Laville M, Vidal H, Lefai E; ''Insulin activates human sterol-regulatory-element-binding protein-1c (SREBP-1c) promoter through SRE motifs.''; Biochem J, 2006 PubMed Europe PMC Scholia
  39. Inoue J, Ito Y, Shimada S, Satoh SI, Sasaki T, Hashidume T, Kamoshida Y, Shimizu M, Sato R; ''Glutamine stimulates the gene expression and processing of sterol regulatory element binding proteins, thereby increasing the expression of their target genes.''; FEBS J, 2011 PubMed Europe PMC Scholia
  40. Defour A, Dessalle K, Castro Perez A, Poyot T, Castells J, Gallot YS, Durand C, Euthine V, Gu Y, Béchet D, Peinnequin A, Lefai E, Freyssenet D; ''Sirtuin 1 regulates SREBP-1c expression in a LXR-dependent manner in skeletal muscle.''; PLoS One, 2012 PubMed Europe PMC Scholia
  41. Walker AK, Yang F, Jiang K, Ji JY, Watts JL, Purushotham A, Boss O, Hirsch ML, Ribich S, Smith JJ, Israelian K, Westphal CH, Rodgers JT, Shioda T, Elson SL, Mulligan P, Najafi-Shoushtari H, Black JC, Thakur JK, Kadyk LC, Whetstine JR, Mostoslavsky R, Puigserver P, Li X, Dyson NJ, Hart AC, Näär AM; ''Conserved role of SIRT1 orthologs in fasting-dependent inhibition of the lipid/cholesterol regulator SREBP.''; Genes Dev, 2010 PubMed Europe PMC Scholia
  42. Düvel K, Yecies JL, Menon S, Raman P, Lipovsky AI, Souza AL, Triantafellow E, Ma Q, Gorski R, Cleaver S, Vander Heiden MG, MacKeigan JP, Finan PM, Clish CB, Murphy LO, Manning BD; ''Activation of a metabolic gene regulatory network downstream of mTOR complex 1.''; Mol Cell, 2010 PubMed Europe PMC Scholia
  43. Sun LP, Li L, Goldstein JL, Brown MS; ''Insig required for sterol-mediated inhibition of Scap/SREBP binding to COPII proteins in vitro.''; J Biol Chem, 2005 PubMed Europe PMC Scholia
  44. Matsuda M, Korn BS, Hammer RE, Moon YA, Komuro R, Horton JD, Goldstein JL, Brown MS, Shimomura I; ''SREBP cleavage-activating protein (SCAP) is required for increased lipid synthesis in liver induced by cholesterol deprivation and insulin elevation.''; Genes Dev, 2001 PubMed Europe PMC Scholia
  45. Sakai J, Nohturfft A, Goldstein JL, Brown MS; ''Cleavage of sterol regulatory element-binding proteins (SREBPs) at site-1 requires interaction with SREBP cleavage-activating protein. Evidence from in vivo competition studies.''; J Biol Chem, 1998 PubMed Europe PMC Scholia
  46. Bengoechea-Alonso MT, Ericsson J; ''A phosphorylation cascade controls the degradation of active SREBP1.''; J Biol Chem, 2009 PubMed Europe PMC Scholia
  47. Lee JN, Zhang X, Feramisco JD, Gong Y, Ye J; ''Unsaturated fatty acids inhibit proteasomal degradation of Insig-1 at a postubiquitination step.''; J Biol Chem, 2008 PubMed Europe PMC Scholia

History

View all...
CompareRevisionActionTimeUserComment
137619view18:03, 5 March 2025KhanspersModified description
135870view04:21, 20 November 2024EweitzIncrease font size
135869view04:15, 20 November 2024EweitzRefine legend
135868view04:10, 20 November 2024EweitzEconomize layout
127880view02:01, 6 January 2024EweitzModified description
116442view09:47, 7 May 2021EweitzModified title
110111view12:30, 17 April 2020FehrhartConnected lines and converted graphical lines
106704view13:13, 17 September 2019MaintBotHMDB identifier normalization
105824view23:03, 15 August 2019KhanspersModified description
90425view18:38, 13 November 2016EgonwAdded two references about the cholesterol-SCAP interaction.
90350view13:37, 6 November 2016EgonwFixed weird chars in several references.
86074view08:50, 29 June 2016MirellaKalafatiModified title
79943view09:38, 28 April 2015Zariadded anotation for AMPK
78494view10:28, 7 January 2015MaintBotadded missing graphIds
73382view05:26, 25 January 2014MaintBotremoved newlines from datanode labels
71987view11:08, 24 October 2013MkutmonChanged Unknown -> RNA for miRNA33a
71698view19:46, 17 October 2013MaintBotUpdated UniProt/TrEMBL data source
68403view09:40, 5 July 2013EveloModified description
68402view09:39, 5 July 2013EveloModified description
68401view09:32, 5 July 2013EveloAdded reference for review paper.
67653view11:44, 26 June 2013DdiglesOntology Term : 'sterol regulatory element-binding protein signaling pathway' added !
63160view20:19, 8 May 2013MaintBotUpdating gpml version
59430view09:37, 27 February 2013SabinedaemenModified description
59171view18:35, 22 February 2013MaintBotUpdated Ensembl data source
58748view12:15, 20 February 2013Sabinedaemenannotations
58745view09:56, 20 February 2013Sabinedaemenannotations
58744view09:52, 20 February 2013Sabinedaemenannotations
58743view09:01, 20 February 2013Sabinedaemenannotations
58578view10:43, 16 February 2013SabinedaemenModified description
58567view16:25, 15 February 2013Sabinedaemenliterature added
58566view16:21, 15 February 2013Sabinedaemenupdate
58565view10:58, 15 February 2013SabinedaemenRBP4
58564view08:59, 15 February 2013SabinedaemenFGF21
55311view15:16, 13 December 2012SabinedaemenUpdate
55303view15:07, 13 December 2012SabinedaemenPeriodical save, work in progress
55295view14:56, 13 December 2012SabinedaemenPeriodical save, work in progress
55279view14:34, 13 December 2012SabinedaemenPeriodical save, work in progress
55259view14:03, 13 December 2012SabinedaemenPeriodical save, work in progress
55238view13:33, 13 December 2012SabinedaemenPeriodical save, work in progress
54933view07:43, 12 December 2012SabinedaemenUpdate
54932view07:36, 12 December 2012SabinedaemenPeriodical save, work in progress
54929view07:26, 12 December 2012SabinedaemenPeriodical save, work in progress
54928view07:16, 12 December 2012SabinedaemenPeriodical save, work in progress
54927view07:06, 12 December 2012SabinedaemenPeriodical save, work in progress
54795view13:46, 9 December 2012SabinedaemenPeriodical save, work in progress
54794view13:36, 9 December 2012SabinedaemenPeriodical save, work in progress
54791view13:26, 9 December 2012SabinedaemenPeriodical save, work in progress
54790view13:16, 9 December 2012SabinedaemenPeriodical save, work in progress
54787view13:05, 9 December 2012SabinedaemenPeriodical save, work in progress
54786view12:55, 9 December 2012SabinedaemenPeriodical save, work in progress

External references

DataNodes

View all...
NameTypeDatabase referenceComment
ACACAGeneProductENSG00000132142 (Ensembl Human)
ACLY GeneProductENSG00000131473 (Ensembl Human)
ACS GeneProductENSG00000154930 (Ensembl Human)
AKTGeneProductENSG00000142208 (Ensembl Human)
AMPKGeneProductENSG00000249325 (Ensembl Human)
ARCComplexactivator recruited cofactor (ARC)-mediator activator complex
ATF6GeneProductENSG00000118217 (Ensembl Human)
CDK8GeneProductENSG00000132964 (Ensembl Human)
CREBGeneProductENSG00000118260 (Ensembl Human)
CYP51A1GeneProductENSG00000001630 (Ensembl Human)
CholesterolMetaboliteHMDB00067 (HMDB)
DBIGeneProductENSG00000155368 (Ensembl Human)
FASN GeneProductENSG00000169710 (Ensembl Human)
FDFTGeneProductENSG00000079459 (Ensembl Human)
FDPSGeneProductENSG00000160752 (Ensembl Human)
GPA GeneProductENSG00000119927 (Ensembl Human)
GSK3GeneProductENSG00000105723 (Ensembl Human)
GlucoseMetaboliteHMDB00122 (HMDB)
GlutamineMetaboliteHMDB00641 (HMDB)
HMGCRGeneProductENSG00000113161 (Ensembl Human)
HMGCSGeneProductENSG00000112972 (Ensembl Human)
IDIGeneProductENSG00000067064 (Ensembl Human)
INSIG1GeneProductENSG00000186480 (Ensembl Human)
INSIG2GeneProductENSG00000125629 (Ensembl Human)
InsulinProteinP01308 (Uniprot/TrEMBL)
LDLRGeneProductENSG00000130164 (Ensembl Human)
LPIN1GeneProductENSG00000134324 (Ensembl Human)
LPLGeneProductENSG00000175445 (Ensembl Human)
LSSGeneProductENSG00000160285 (Ensembl Human)
LXRENSG00000131408 (Ensembl Human)
MDHGeneProductENSG00000014641 (Ensembl Human)
MVDGeneProductENSG00000167508 (Ensembl Human)
NFYGeneProductENSG00000001167 (Ensembl Human)
OxysterolsMetaboliteOxysterols (Wikipedia)
PGC-1betaGeneProductENSG00000155846 (Ensembl Human)
PI3KGeneProductENSG00000121879 (Ensembl Human)
PPARGGeneProductENSG00000132170 (Ensembl Human)
PUFAsMetaboliteInhibition of SREBP1 processing
S1PGeneProductENSG00000140943 (Ensembl Human)
S2PGeneProductENSG00000012174 (Ensembl Human)
SAR1AGeneProductENSG00000079332 (Ensembl Human)
SAR1BGeneProductENSG00000152700 (Ensembl Human)
SCAPGeneProductENSG00000114650 (Ensembl Human)
SCARB1GeneProductENSG00000073060 (Ensembl Human)
SCDGeneProductENSG00000099194 (Ensembl Human)
SEC13GeneProductENSG00000157020 (Ensembl Human)
SEC23AGeneProductENSG00000100934 (Ensembl Human)
SEC23BGeneProductENSG00000101310 (Ensembl Human)
SEC24AGeneProductENSG00000113615 (Ensembl Human)
SEC24BGeneProductENSG00000138802 (Ensembl Human)
SEC24CGeneProductENSG00000176986 (Ensembl Human)
SEC24DGeneProductENSG00000150961 (Ensembl Human)
SEC31AGeneProductENSG00000138674 (Ensembl Human)
SEC31BGeneProductENSG00000075826 (Ensembl Human)
SIRT1GeneProductENSG00000096717 (Ensembl Human)
SP1GeneProductENSG00000185591 (Ensembl Human)
SQLEGeneProductENSG00000104549 (Ensembl Human)
SREBF2GeneProductENSG00000198911 (Ensembl Human)
SREBP1a,-cGeneProductENSG00000072310 (Ensembl Human)
SREBP2GeneProductENSG00000198911 (Ensembl Human)
TRC8GeneProduct
UFAsMetabolite
YY1GeneProductENSG00000100811 (Ensembl Human)
importin betaGeneProductENSG00000108424 (Ensembl Human)
mTORC1GeneProductENSG00000198793 (Ensembl Human)
miRNA33a
miRNA33bRna
nSREBPGeneProduct
nSREBP1a,-cGeneProduct
nSREBP2GeneProduct

Annotated Interactions

No annotated interactions